PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf01413g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 190aa    MW: 20427.1 Da    PI: 7.9331
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf01413g00006.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.34.6e-3067120155
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               +prl+Wtp+LH+rFv+av+++ G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Peaxi162Scf01413g00006.1  67 RPRLVWTPQLHKRFVDAVAHI-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 120
                               59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.24E-2064124IPR009057Homeodomain-like
PROSITE profilePS5129410.10464123IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-3066125IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-2468120IPR006447Myb domain, plants
PfamPF002492.7E-770119IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MPLSQTLITP DLAIAFDIQN PNSPIPKTHQ TVVNSSAEFE YSADLNGGTA GSGGGGGVDE  60
PARTLKRPRL VWTPQLHKRF VDAVAHIGIK NAVPKTIMQL MSVDGLTREN VASHLQKYRL  120
YLKRMQQGGH SSNGNSMPDS ATDNLFASSP RMGMSVHSTS PVLPSYVEDL ESATAANGRK  180
VLTLFPTVDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-2166125463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754491e-59HG975449.1 Solanum pennellii chromosome ch10, complete genome.
GenBankHG9755221e-59HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009790047.11e-69PREDICTED: transcription factor PCL1-like
RefseqXP_016480389.11e-69PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB43e-41PCL1_ARATH; Transcription factor LUX
TrEMBLK4D2Y31e-67K4D2Y3_SOLLC; Uncharacterized protein
STRINGSolyc10g080960.1.13e-67(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24322354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.14e-57G2-like family protein